Proteintech, 68163-1-Ig, PPP3CA Monoclonal antibody

Size: 20ul / 150ul The PPP3CA (68163-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP3CA in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68163-1-Ig targets PPP3CA in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: SH-SY5Y cells, rabbit skeletal muscle tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, rat skeletal muscle Positive IP detected in: rat brain tissue Positive IHC detected in: human thyroid cancer tissue, mouse skeletal muscle tissue, rat skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PPP3CA, also called calcineurin Aα, is the only serine/threonine protein phosphatase under the control of Ca2+/calmodulin, and plays a critical role in the coupling of Ca2+ signals to cellular responses. Ca2+ signaling plays a central role in hypertrophic growth of cardiac and skeletal muscle in response to mechanical load and a variety of signals. Therefore, PPP3CA plays an important role in muscle differentiation, especially in muscle fiber type conversion. It is also involved in osteoclast regulation, regulating bone formation through an effect on osteoblast differentiation. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32642 Product name: Recombinant human PPP3CA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 3-302 aa of BC025714 Sequence: EPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPSL Predict reactive species Full Name: protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC025714 Gene Symbol: PPP3CA Gene ID (NCBI): 5530 RRID: AB_2923682 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08209 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.