Proteintech, 68164-1-Ig, TCEB1 Monoclonal antibody

Size: 20ul / 150ul The TCEB1 (68164-1-Ig) by Proteintech is a Monoclonal antibody targeting TCEB1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68164-1-Ig targets TCEB1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells. HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: T-47D cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TCEB1, also named as RNA polymerase II transcription factor SIII subunit C, belongs to the SKP1 family. It mediates the ubiquitination of ECS-E3 ubiquitin-protein ligase complexes. TCEB1 is overexpressed in prostate cancer cell line PC-3 and breast cancer cell line SK-BR-3. TCEB1 also promotes invasion of prostate cancer cells (PMID:18844214). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22601 Product name: Recombinant human TCEB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-112 aa of BC013809 Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC Predict reactive species Full Name: transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C) Calculated Molecular Weight: 112 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC013809 Gene Symbol: TCEB1 Gene ID (NCBI): 6921 RRID: AB_2923683 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15369 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.