Proteintech, 68175-1-Ig, BLVRA Monoclonal antibody

Size: 20ul / 150ul The BLVRA (68175-1-Ig) by Proteintech is a Monoclonal antibody targeting BLVRA in WB, IF/ICC, ELISA applications with reactivity to human samples 68175-1-Ig targets BLVRA in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, DU 145 cells, U2OS cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BLVRA(Biliverdin reductase A) is also named BLVR, BVR, and belongs to the biliverdin reductase subfamily. It catalyzes the conversion of biliverdin to bilirubin in the presence of NADPH or NADH. This protein can exist as a dimer(PMID:11773068). Defects in BLVRA are the cause of hyperbiliverdinemia (HBLVD). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32730 Product name: Recombinant human BLVRA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC008456 Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK Predict reactive species Full Name: biliverdin reductase A Calculated Molecular Weight: 33.2 kDa Observed Molecular Weight: 37-40 kDa, 66 kDa GenBank Accession Number: BC008456 Gene Symbol: BLVRA Gene ID (NCBI): 644 RRID: AB_2935266 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P53004 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.