Proteintech, 68176-1-Ig, SYNGR1 Monoclonal antibody

Size: 20ul / 150ul The SYNGR1 (68176-1-Ig) by Proteintech is a Monoclonal antibody targeting SYNGR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68176-1-Ig targets SYNGR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: mouse retina tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Synaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558) Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31309 Product name: Recombinant human SYNGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-92 aa of BC000731 Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYF Predict reactive species Full Name: synaptogyrin 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC000731 Gene Symbol: SYNGR1 Gene ID (NCBI): 9145 RRID: AB_2935267 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43759 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.