Product Description
Size: 20ul / 150ul
The SYNGR1 (68176-1-Ig) by Proteintech is a Monoclonal antibody targeting SYNGR1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples
68176-1-Ig targets SYNGR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Applications
Positive WB detected in: mouse retina tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Background Information
Synaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558)
Specification
Tested Reactivity: human, mouse, rat, pig, rabbit
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag31309 Product name: Recombinant human SYNGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-92 aa of BC000731 Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYF Predict reactive species
Full Name: synaptogyrin 1
Calculated Molecular Weight: 25 kDa
Observed Molecular Weight: 29 kDa
GenBank Accession Number: BC000731
Gene Symbol: SYNGR1
Gene ID (NCBI): 9145
RRID: AB_2935267
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: O43759
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924