Iright
BRAND / VENDOR: Proteintech

Proteintech, 68178-1-Ig, PPA1 Monoclonal antibody

CATALOG NUMBER: 68178-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PPA1 (68178-1-Ig) by Proteintech is a Monoclonal antibody targeting PPA1 in WB, IF/ICC, ELISA applications with reactivity to Human, Rat samples 68178-1-Ig targets PPA1 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PPA1(Inorganic pyrophosphatase) is also named as IOPPP, PP and PPase. It maintains the thermodynamic favorability of these reactions by catalyzing the hydrolysis of pyrophosphates into organic phosphates, which are then exported across the cell membrane(PMID:16300924).The erythrocyte inorganic pyrophosphatase molecule would appear to be a dimer(PMID:4130389). Specification Tested Reactivity: Human, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7049 Product name: Recombinant human PPA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-289 aa of BC001022 Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN Predict reactive species Full Name: pyrophosphatase (inorganic) 1 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC001022 Gene Symbol: PPA1 Gene ID (NCBI): 5464 RRID: AB_2935269 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924