Proteintech, 68180-1-Ig, PSMB2 Monoclonal antibody

Size: 20ul / 150ul The PSMB2 (68180-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMB2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68180-1-Ig targets PSMB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, SKOV-3 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HCT 116 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PSMB2(proteasome subunit beta type-2) is also named as macropain subunit C7-I, proteasome component C7-I, multicatalytic endopeptidase complex subunit C7-I and belongs to the peptidase T1B family. It is involved in an ATP/ubiquitin-dependent non-lysosomal proteolytic pathway. The up-regulation of PSMB2 may indicate the activated neuronal defensive mechanism in VAD(vitamin A depletion) brain regions, which may underlie the VAD-related psychosis behavior(PMID:21190828). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7308 Product name: Recombinant human PSMB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC000268 Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 2 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC000268 Gene Symbol: PSMB2 Gene ID (NCBI): 5690 RRID: AB_2935271 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P49721 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.