Proteintech, 68181-1-Ig, COMT Monoclonal antibody

Size: 20ul / 150ul The COMT (68181-1-Ig) by Proteintech is a Monoclonal antibody targeting COMT in WB, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 68181-1-Ig targets COMT in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293 cells, K-562 cells, pig adrenal gland tissue, human testis tissue, rat testis tissue, mouse testis tissue Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Catechol O-methyltransferase (COMT) is an important enzyme that catalyzes O-methylation and inactivation of metabolically active catechol-containing bioactive molecules and drugs. The mammalian COMT enzyme exists in soluble form (24-26 kDa) and membrane-bound form (28-30 kDa), which are encoded by a single gene utilizing different promoters. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6502 Product name: Recombinant human COMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-182 aa of BC000419 Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP Predict reactive species Full Name: catechol-O-methyltransferase Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 28-30 kDa GenBank Accession Number: BC000419 Gene Symbol: COMT Gene ID (NCBI): 1312 RRID: AB_2935272 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P21964 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.