Proteintech, 68186-1-Ig, ARL8A/ARL8B Monoclonal antibody

Size: 20ul / 150ul The ARL8A/ARL8B (68186-1-Ig) by Proteintech is a Monoclonal antibody targeting ARL8A/ARL8B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 68186-1-Ig targets ARL8A/ARL8B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rabbit brain tissue, LNCaP cells, human placenta tissue, HeLa cells, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: A549 cells, C6 cells, Neuro-2a cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information ARL8A (ADP-ribosylation factor-like protein 8A) is also named as ARL10B, GIE2 and belongs to the small GTPase superfamily. ARL8A is localized to lysosomes in mammalian cells (PMID: 16537643). In neurons, ARL8A mediates the anterograde axonal long-range transport of presynaptic lysosome-related vesicles that are required for presynaptic biogenesis and synaptic function. ARL8A is upregulated in many cancers such as endometrial cancer (PMID: 32070877), colorectal cancer (PMID: 30546056) and inflammatory breast cancer (PMID: 27648361), and has been associated with poor survival outcomes. ARL8A/ARL8B can be recognized by this antibody. Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10758 Product name: Recombinant human ARL8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC015408 Sequence: MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Predict reactive species Full Name: ADP-ribosylation factor-like 8A Calculated Molecular Weight: 186 aa, 21 kDa Observed Molecular Weight: 18 kDa, 21 kDa GenBank Accession Number: BC015408 Gene Symbol: ARL8A Gene ID (NCBI): 127829 RRID: AB_3085047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96BM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.