Proteintech, 68187-1-Ig, PABPC4 Monoclonal antibody

Size: 20ul / 150ul The PABPC4 (68187-1-Ig) by Proteintech is a Monoclonal antibody targeting PABPC4 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 68187-1-Ig targets PABPC4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HCT 116 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IHC detected in: human colon cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Poly(A)-binding protein (PABP), a nucleocytoplasmic shuttling protein, has a fundamental role in promoting gene expression by enhancing mRNA translation and stability(PMID: 21940797). Poly(A)-binding protein 4 (PABPC4), one of the homologs of PABP, was initially identified as a human T-cell activation-induced protein. PABPC4 may also be involved in the regulation of protein translation in platelets and megakaryocytes or may participate in the binding or stabilization of polyadenylates in platelet dense granules(NCBI). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6813 Product name: Recombinant human PABPC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 285-631 aa of BC065540 Sequence: QERISRYQGVNLYIKNLDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGSKPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRPPYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQSGPRPTLRHLAPTGNAPASRGLPTTTQRVGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQAPQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS Predict reactive species Full Name: poly(A) binding protein, cytoplasmic 4 (inducible form) Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC065540 Gene Symbol: PABPC4 Gene ID (NCBI): 8761 RRID: AB_2935277 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13310 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.