Proteintech, 68193-1-Ig, RPAP1 Monoclonal antibody

Size: 20ul / 150ul The RPAP1 (68193-1-Ig) by Proteintech is a Monoclonal antibody targeting RPAP1 in WB, ELISA, FC (Intra) applications with reactivity to Human, mouse, rat samples 68193-1-Ig targets RPAP1 in WB, ELISA, FC (Intra) applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, mouse brain tissue, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information RNA polymerase II-associated protein 1 (RPAP1) encodes a nuclear 153-kDa protein, and forms an interface between the RNA polymerase II (RNAPII) enzyme and chaperone/scaffolding protein, suggesting that it is required to connect RNA polymerase II to regulators of protein complex formation. RPAP1 is required for interaction of the RNA polymerase II complex with acetylated histone H3 and the subsequent DNA transcription. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7856 Product name: Recombinant human RPAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC000246 Sequence: MLSRPKPGESEVDLLHFQSQFLAAGAAPAVQLVKKGNRGGGDANSDRPPLQDHRDVVMLDNLPDLPPALVPSPPKRARPSPGHCLPEDEDPEERLRRHDQHITAVLTKIIERDTSSVAVNLPVPSGVAFPAVFLRSRDTQGKSATSGKRSIFAQEIAARRIAEAKGPSVGEVVPNVGPPEGAVTCETPTPRNQGCQLPGSSHSFQGPNLVTGKGLRDQEAEQEAQTIHEENIARLQAMAPEEILQEQQRLLAQLDPSLVAFLRSHSHTQEQTGETASEEQRPGGPSANVTKEEPLMSAFASEPRKRDKLEPEAPALALPVTPQKEWLHMDTVELEKLHWTQDLPPVRRQQT Predict reactive species Full Name: RNA polymerase II associated protein 1 Calculated Molecular Weight: 153 kDa Observed Molecular Weight: 153 kDa GenBank Accession Number: BC000246 Gene Symbol: RPAP1 Gene ID (NCBI): 26015 RRID: AB_2935282 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BWH6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.