Proteintech, 68199-1-Ig, IDH3B Monoclonal antibody

Size: 20ul / 150ul The IDH3B (68199-1-Ig) by Proteintech is a Monoclonal antibody targeting IDH3B in WB, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit, Pig samples 68199-1-Ig targets IDH3B in WB, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig heart tissue, rabbit heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Isocitrate dehydrogenase 3 (IDH3) is a key enzyme in the mitochondrial tricarboxylic acid (TCA) cycle, which catalyzes the decarboxylation of isocitrate into α-ketoglutarate and concurrently converts NAD+ into NADH. IDH3B(Isocitrate dehydrogenase 3 (NAD+) beta), also named as RP46, is the beta subunit of IDH3 and controls its substrate levels in the TCA cycle, and it is required for sperm mitochondrial metabolism and spermiogenesis (PMID: 18806796, PMID: 35985423). In addition, DH3B expression increased PFKFB3 protein levels and enhanced glucose uptake, and high expression of IDH3B correlated with poor survival in patients with ESCC, suggesting a potential application of IDH3B in prognosis (PMID: 31053633). Specification Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8693 Product name: Recombinant human IDH3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-385 aa of BC001960 Sequence: MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS Predict reactive species Full Name: isocitrate dehydrogenase 3 (NAD+) beta Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC001960 Gene Symbol: IDH3B Gene ID (NCBI): 3420 RRID: AB_2935288 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.