Iright
BRAND / VENDOR: Proteintech

Proteintech, 68202-1-Ig, EIF3B Monoclonal antibody

CATALOG NUMBER: 68202-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The EIF3B (68202-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF3B in WB, ELISA applications with reactivity to Human, mouse, rat samples 68202-1-Ig targets EIF3B in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, A431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information EIF3B, also named Eukaryotic translation initiation factor 3 subunit B, is an 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as an RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation, and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31427 Product name: Recombinant human EIF3B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 381-562 aa of BC001173 Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit B Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 115 kDa GenBank Accession Number: BC001173 Gene Symbol: EIF3B Gene ID (NCBI): 8662 RRID: AB_2935290 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P55884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924