Proteintech, 68204-1-Ig, ARF4 Monoclonal antibody

Size: 20ul / 150ul The ARF4 (68204-1-Ig) by Proteintech is a Monoclonal antibody targeting ARF4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68204-1-Ig targets ARF4 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, rat brain tissue, A549 cells, mouse brain tissue, HeLa cells, HepG2 cells, Jurkat cells Positive IHC detected in: human stomach cancer tissue, human liver tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ARF4, also named as ARF2, belongs to the small GTPase superfamily and Arf family. ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily, with 20 kDa protein size. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. ARF4 and ARF5 are class II ARFs. Their function are not fully described. (PMID: 7759471, PMID: 16042562). This antibody can bind ARFs for the close sequences. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25522 Product name: Recombinant human ARF4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-180 aa of BC003364 Sequence: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR Predict reactive species Full Name: ADP-ribosylation factor 4 Calculated Molecular Weight: 180 aa, 21 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC003364 Gene Symbol: ARF4 Gene ID (NCBI): 378 RRID: AB_2935292 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18085 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.