Proteintech, 68206-1-Ig, SIRP beta 1/CD172b Monoclonal antibody

Size: 20ul / 150ul The SIRP beta 1/CD172b (68206-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRP beta 1/CD172b in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68206-1-Ig targets SIRP beta 1/CD172b in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rat cerebellum tissue, rabbit cerebellum tissue, pig cerebellum tissue, mouse brain tissue, rat brain tissue, rabbit brain tissue, pig brain tissue, U-937 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: OS-RC-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SIRP Beta 1 is a member of the signal-regulatory-protein (SIRP) family and also belongs to the immunoglobulin superfamily. SIRP family members are cell surface signaling receptors differentially expressed in leukocytes and the central nervous system. SIRP Beta 1 interacts with TYROBP/DAP12, a protein-bearing immunoreceptor tyrosine-based activation motif. SIRP Beta 1 also participates in the recruitment of tyrosine kinase SYK. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28615 Product name: Recombinant human SIRPB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC025286 Sequence: MPVPASWPHLPSPFLLMTLLLGRLTGVAGEDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVREPALAPTAPLLVALLLGPKLLLVVGVSAIYICWKQKA Predict reactive species Full Name: signal-regulatory protein beta 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC025286 Gene Symbol: SIRPB1 Gene ID (NCBI): 10326 RRID: AB_2935294 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00241 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.