Proteintech, 68209-1-Ig, DNM2 Monoclonal antibody

Size: 20ul / 150ul The DNM2 (68209-1-Ig) by Proteintech is a Monoclonal antibody targeting DNM2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68209-1-Ig targets DNM2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DNM2, also known as DYN2, DYNII, CMTDI1, CMTDIB, belongs to the dynamin family. DNM2 is a ubiquitously expressed large GTPase involved in clathrin-dependent and -independent endocytosis and intracellular membrane trafficking. DNM2 plays a role in the regulation of neuron morphology, axon growth, and the formation of neuronal growth cones. Dynamins are associated with microtubules. DNM2 plays an important role in endocytosis and is involved in cytokinesis (PMID: 33713620, 12498685). Mutations in DNM2 cause dominant centronuclear myopathy (PMID: 16227997). Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) (PMID: 15731758). Alternate splicing results in multiple transcript variants. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6274 Product name: Recombinant human DNM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 518-866 aa of BC054501 Sequence: RRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRRPPAAPSRPTIIRPAEPSLLD Predict reactive species Full Name: dynamin 2 Calculated Molecular Weight: 98 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC054501 Gene Symbol: DNM2 Gene ID (NCBI): 1785 RRID: AB_2935297 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50570 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.