Proteintech, 68212-1-Ig, NOTCH2/NOTCH2NL Monoclonal antibody

Size: 20ul / 150ul The NOTCH2/NOTCH2NL (68212-1-Ig) by Proteintech is a Monoclonal antibody targeting NOTCH2/NOTCH2NL in WB, IF/ICC, ELISA applications with reactivity to human samples 68212-1-Ig targets NOTCH2/NOTCH2NL in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: hTERT-RPE1 cells, U-87 MG cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Notch 2 is a member of the notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. Notch2, like other Norch genes, functions in development of various tissues. This antibody can recognize NOTCH2 and NOTCH2NL. The antibody detects the full-length NOTCH2 protein about 250-265 kDa. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1679 Product name: Recombinant human NOTCH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-254 aa of BC019835 Sequence: PAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGICLNLPGSYQCQCLQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN Predict reactive species Full Name: Notch homolog 2 (Drosophila) N-terminal like Calculated Molecular Weight: 265 kDa Observed Molecular Weight: 250-265 kDa GenBank Accession Number: BC019835 Gene Symbol: NOTCH2NL Gene ID (NCBI): 388677 RRID: AB_2935300 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P0DPK4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.