Proteintech, 68222-1-Ig, CD59 Monoclonal antibody

Size: 20ul / 150ul The CD59 (68222-1-Ig) by Proteintech is a Monoclonal antibody targeting CD59 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 68222-1-Ig targets CD59 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human colostrum, A549 cells, HeLa cells, human milk, MCF-7 cells, HepG2 cells, K-562 cells, Jurkat cells, human placenta tissue Positive IHC detected in: human placenta tissue, human lung cancer tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human placenta tissue Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CD59, also named as MIC11, MIN1, MIN2, MIN3, MSK21, MIRL, MACIF, HRF20 and 1F5 antigen, is a cell surface molecule glycoprotein with MW 18-25 kDa. It acts as a determinant of proximal-distal cell identity. CD59 acts by binding to the C8 and/or C9 complements of the assembling membrane attack complex (MAC), thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. It is involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag32834 Product name: Recombinant human CD59 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-128 aa of BC001506 Sequence: MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP Predict reactive species Full Name: CD59 molecule, complement regulatory protein Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 18-25 kDa GenBank Accession Number: BC001506 Gene Symbol: CD59 Gene ID (NCBI): 966 RRID: AB_2935310 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13987 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.