Proteintech, 68226-1-Ig, IMMT Monoclonal antibody

Size: 20ul / 150ul The IMMT (68226-1-Ig) by Proteintech is a Monoclonal antibody targeting IMMT in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 68226-1-Ig targets IMMT in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0102 Product name: Recombinant human IMMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-297 aa of BC002412 Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK Predict reactive species Full Name: inner membrane protein, mitochondrial (mitofilin) Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC002412 Gene Symbol: IMMT Gene ID (NCBI): 10989 RRID: AB_2935314 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.