Proteintech, 68234-1-Ig, DCLK1 Monoclonal antibody

Size: 20ul / 150ul The DCLK1 (68234-1-Ig) by Proteintech is a Monoclonal antibody targeting DCLK1 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68234-1-Ig targets DCLK1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, fetal human brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive FC (Intra) detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information DCLK1 (Serine/threonine-protein kinase DCLK1) is also named as DCAMKL1, DCDC3A, KIAA0369 and belongs to the CAMK Ser/Thr protein kinase family. It is a microtubule-associated kinase that can undergo autophosphorylation and it also has microtubule-polymerizing activity that is independent of its protein kinase activity (PMID: 11124993). It plays a unique role in mitotic spindle integrity during early neurogenesis in radial glial cell proliferation and their radial process stability. DCLK1 is a unique marker for distinguishing tumor stem cells from intestinal normal stem cells (PMID: 23202126). This protein has 4 isoforms produced by alternative splicing with the molecular weight of 82 kDa, 81 kDa, 47 kDa and 48 kDa. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17110 Product name: Recombinant human DCLK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 623-729 aa of BC152456 Sequence: LITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM Predict reactive species Full Name: doublecortin-like kinase 1 Calculated Molecular Weight: 729 aa, 81 kDa Observed Molecular Weight: 46 kDa, 82 kDa GenBank Accession Number: BC152456 Gene Symbol: DCLK1 Gene ID (NCBI): 9201 RRID: AB_2935321 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15075 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.