Product Description
Size: 20ul / 150ul
The SUPT16H (68243-1-Ig) by Proteintech is a Monoclonal antibody targeting SUPT16H in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
68243-1-Ig targets SUPT16H in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 164.7 cells
Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Background Information
SUPT16H, also named as FACT140, FACTP140, SPT16 and CDC68, belongs to the peptidase M24 family and SPT16 subfamily. SUPT16H is a component of the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. During transcription elongation the FACT complex acts as a histone chaperone that both destabilizes and restores nucleosomal structure. It facilitates the passage of RNA polymerase II and transcription by promoting the dissociation of one histone H2A-H2B dimer from the nucleosome, then subsequently promotes the reestablishment of the nucleosome following the passage of RNA polymerase II. The FACT complex is probably also involved in phosphorylation of 'Ser-392' of p53/TP53 via its association with CK2 (casein kinase II). It also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag29459 Product name: Recombinant human SUPT16H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 926-1047 aa of NM_007192 Sequence: EPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDYSKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK Predict reactive species
Full Name: suppressor of Ty 16 homolog (S. cerevisiae)
Calculated Molecular Weight: 120 kDa
Observed Molecular Weight: 135 kDa
GenBank Accession Number: NM_007192
Gene Symbol: SUPT16H
Gene ID (NCBI): 11198
RRID: AB_2935330
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: Q9Y5B9
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924