Iright
BRAND / VENDOR: Proteintech

Proteintech, 68249-1-Ig, PDCD2L Monoclonal antibody

CATALOG NUMBER: 68249-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PDCD2L (68249-1-Ig) by Proteintech is a Monoclonal antibody targeting PDCD2L in WB, IF/ICC, ELISA applications with reactivity to Human samples 68249-1-Ig targets PDCD2L in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HCT 116 cells, HeLa cells, K-562 cells, HepG2 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PDCD2L was aberrantly expressed in multiple types of human cancers, and associated with clinical stage and molecular subtype and PDCD2L could be served as a biomarker of CRC (PMID: 35216602). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30807 Product name: Recombinant human PDCD2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-179 aa of BC006146 Sequence: CACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVP Predict reactive species Full Name: programmed cell death 2-like Calculated Molecular Weight: 358 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC006146 Gene Symbol: PDCD2L Gene ID (NCBI): 84306 RRID: AB_3085049 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BRP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924