Proteintech, 68254-1-Ig, ABL1 Monoclonal antibody

Size: 20ul / 150ul The ABL1 (68254-1-Ig) by Proteintech is a Monoclonal antibody targeting ABL1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 68254-1-Ig targets ABL1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: U2OS cells, HepG2 cells, MCF-7 cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ABL1, also named as ABL, JTK7, c-ABL and p150, belongs to the protein kinase superfamily, Tyr protein kinase family and ABL subfamily. ABL1 regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. ABL1 localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. It regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. ABL1 catalyze the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL). The antibody is specific to ABL1. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26152 Product name: Recombinant human ABL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 801-900 aa of NM_005157 Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP Predict reactive species Full Name: c-abl oncogene 1, receptor tyrosine kinase Calculated Molecular Weight: 123 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: NM_005157 Gene Symbol: ABL1 Gene ID (NCBI): 25 RRID: AB_2935339 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.