Iright
BRAND / VENDOR: Proteintech

Proteintech, 68260-1-Ig, SNX12 Monoclonal antibody

CATALOG NUMBER: 68260-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SNX12 (68260-1-Ig) by Proteintech is a Monoclonal antibody targeting SNX12 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68260-1-Ig targets SNX12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SNXs (sorting nexins) are a diverse group of cytoplasmic and membrane-associated proteins that are classified by the presence of a phospholipid-binding motif-the PX domain (PMID:12461558). SNXs are involved in endocytosis and protein trafficking. SNX12 (Sorting nexin 12) is localized in early endosomes and SNX12 overexpression specifically prevents the degradative pathway from early to late endosomes/lysosomes (PMID: 22719997). SNX12 may participate in Alzheimer's disease (AD) pathology by regulating the endocytosis of BACE1 and affecting β-processing of APP (PMID: 22709416). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3014 Product name: Recombinant human SNX12 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-162 aa of BC020559 Sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLA Predict reactive species Full Name: sorting nexin 12 Calculated Molecular Weight: 172 aa, 20 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC020559 Gene Symbol: SNX12 Gene ID (NCBI): 29934 RRID: AB_2935345 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UMY4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924