Iright
BRAND / VENDOR: Proteintech

Proteintech, 68263-1-Ig, POLR3D Monoclonal antibody

CATALOG NUMBER: 68263-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The POLR3D (68263-1-Ig) by Proteintech is a Monoclonal antibody targeting POLR3D in WB, FC (Intra), ELISA applications with reactivity to human, rabbit samples 68263-1-Ig targets POLR3D in WB, FC (Intra), ELISA applications and shows reactivity with human, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, rabbit brain tissue, K-562 cells, HEK-293 cells, HeLa cells, Jurkat cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Polymerase (RNA) III (DNA directed) polypeptide D(POLR3D) plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses and acts as nuclear and cytosolic DNA sensor involved in innate immune response. POLR3D can sense non-self dsDNA that serves as template for transcription into dsRNA. Specification Tested Reactivity: human, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7646 Product name: Recombinant human POLR3D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 45-398 aa of BC004484 Sequence: SRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR Predict reactive species Full Name: polymerase (RNA) III (DNA directed) polypeptide D, 44kDa Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC004484 Gene Symbol: POLR3D Gene ID (NCBI): 661 RRID: AB_2935348 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924