Proteintech, 68271-1-Ig, MAP4 Monoclonal antibody

Size: 20ul / 150ul The MAP4 (68271-1-Ig) by Proteintech is a Monoclonal antibody targeting MAP4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 68271-1-Ig targets MAP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: NCCIT cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, MOLT-4 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information MAP4 is a ubiquitously expressed microtubule-associated protein involved in the organization and stabilization of microtubules during various cellular activities. Recently it has been reported that expression of MAP4 was upregulated in esophageal squamous cell carcinoma (ESCC). MAP4 has been considered as an independent prognostic factor for ESCC. The predicted molecular weight of MAP4 is about 120 kDa, while higher molecular weight around 200-250 kDa is usually observed in WB test, which may be the result of glycosylation. (26876215, 8647865) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1741 Product name: Recombinant human MAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 629-979 aa of BC012794 Sequence: KSTQTVAKTTTAAAVASTGPSSRSPSTLLPKKPTAIKTEGKPAEVKKMTAKSVPADLSRPKSTSTSSMKKTTTLSGTAPAAGVVPSRVKATPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSKVGSTENIKHQPGGGRAKVEKKTEAAATTRKPESNAVTKTAGPIASAQKQPAGKVQIVSKKVSYSHIQSKCGSKDNIKHVPGGGNVQIQNKKVDISKVSSKCGSKANIKHKPGGGDVKIESQKLNFKEKAQAKVGSLDNVGHLPAGGAVKTEGGGSEAPLCPGPPAGEEPAISEAAPEAGAPTSASGLNGHPTLSGGGDQREAQTLDSQIQETSI Predict reactive species Full Name: microtubule-associated protein 4 Calculated Molecular Weight: 121 kDa Observed Molecular Weight: 210-240 kDa GenBank Accession Number: BC012794 Gene Symbol: MAP4 Gene ID (NCBI): 4134 RRID: AB_2935354 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P27816 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.