Iright
BRAND / VENDOR: Proteintech

Proteintech, 68294-1-Ig, Cytokeratin 6A Monoclonal antibody

CATALOG NUMBER: 68294-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Cytokeratin 6A (68294-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 6A in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 68294-1-Ig targets Cytokeratin 6A in WB, IF, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HaCaT cells, A431 cells, human saliva, rat skin tissue, mouse skin tissue Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1150-1:4600 Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as a marker for epidermal hyperproliferation and differentiation. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0882 Product name: Recombinant human KRT6A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 364-564 aa of BC008807 Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH Predict reactive species Full Name: keratin 6A Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC008807 Gene Symbol: Cytokeratin 6A Gene ID (NCBI): 3853 RRID: AB_2935374 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02538 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924