Proteintech, 68312-1-Ig, DYNLT1 Monoclonal antibody

Size: 20ul / 150ul The DYNLT1 (68312-1-Ig) by Proteintech is a Monoclonal antibody targeting DYNLT1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68312-1-Ig targets DYNLT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: H9C2 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DYNLT (or Tctex-1) was originally described as a light chain component of the dynein motor complex. Tctex-1 also has several dynein-independent functions, including roles in G protein signaling activation and neuronal growth. Tctex-1 is selectively enriched in proliferating neural progenitors of both embryonic and adult brains. Genetic knockdown of Tctex-1 in radial precursors promoted neurogenesis, indicating its implication in regulation of cortical neurogenesis. (PMID: 19448628) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33072 Product name: Recombinant human DYNLT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-113 aa of BC029412 Sequence: MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI Predict reactive species Full Name: dynein, light chain, Tctex-type 1 Calculated Molecular Weight: 113 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC029412 Gene Symbol: DYNLT1 Gene ID (NCBI): 6993 RRID: AB_2935390 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P63172 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.