Proteintech, 68325-1-Ig, SH3GLB2 Monoclonal antibody

Size: 20ul / 150ul The SH3GLB2 (68325-1-Ig) by Proteintech is a Monoclonal antibody targeting SH3GLB2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68325-1-Ig targets SH3GLB2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells, rat brain tissue, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, mouse brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SH3GLB2 is an endophilin-related protein family with 395-amino acid protein and contains an N-terminal domain, a central coiled-coil region, and a C-terminal SH3 domain. SH3GLB2 is expressed in many tissues, including skeletal muscle, adipocytes, brain, lung, colon, and mammary gland. SH3GLB2 was expressed in the cytoplasm of transfected HeLa cells and was excluded from nuclei(PMID: 11161816). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8932 Product name: Recombinant human SH3GLB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-395 aa of BC014635 Sequence: MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS Predict reactive species Full Name: SH3-domain GRB2-like endophilin B2 Calculated Molecular Weight: 395 aa, 44 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC014635 Gene Symbol: SH3GLB2 Gene ID (NCBI): 56904 RRID: AB_2935397 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NR46 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.