Proteintech, 68326-1-Ig, AZI2 Monoclonal antibody

Size: 20ul / 150ul The AZI2 (68326-1-Ig) by Proteintech is a Monoclonal antibody targeting AZI2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68326-1-Ig targets AZI2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, MDA-MB-231 cells, SK-BR-3 cells, LNCaP cells, HEK-293 cells, K-562 cells, HSC-T6 cells, 4T1 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information AZI2, also known as NAP1, is a TNF receptor (TNFR)-associated factor family member-associated NF-κB activator-binding kinase 1-binding protein that regulates the production of IFNs. It is an adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. NAP1 is a kind of adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. (PMID: 21931631) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6755 Product name: Recombinant human AZI2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-264 aa of BC001139 Sequence: MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKGKSLFTGNH Predict reactive species Full Name: 5-azacytidine induced 2 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC001139 Gene Symbol: AZI2 Gene ID (NCBI): 64343 RRID: AB_2935398 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H6S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.