Proteintech, 68329-1-Ig, NDUFS6 Monoclonal antibody

Size: 20ul / 150ul The NDUFS6 (68329-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFS6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, rabbit, chicken samples 68329-1-Ig targets NDUFS6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, rabbit, chicken samples. Tested Applications Positive WB detected in: rabbit heart tissue, HepG2 cells, rat heart tissue, mouse heart tissue, chicken heart tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information NDUFS6(NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial) is also named as CI-13kD-A, NADH-ubiquinone oxidoreductase 13 kDa-A subunit and belongs to the complex I NDUFS6 subunit family.It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Specification Tested Reactivity: human, mouse, rat, rabbit, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6286 Product name: Recombinant human NDUFS6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC046155 Sequence: MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 13-15 kDa GenBank Accession Number: BC046155 Gene Symbol: NDUFS6 Gene ID (NCBI): 4726 RRID: AB_2935401 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75380 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.