Iright
BRAND / VENDOR: Proteintech

Proteintech, 68331-1-Ig, ZNHIT3 Monoclonal antibody

CATALOG NUMBER: 68331-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNHIT3 (68331-1-Ig) by Proteintech is a Monoclonal antibody targeting ZNHIT3 in WB, IF/ICC, ELISA applications with reactivity to Human samples 68331-1-Ig targets ZNHIT3 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: hTERT-RPE1 cells, Jurkat cells, T-47D cells, MOLT-4 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ZNHIT3, also named TRIP3, belongs to the zinc finger HIT (Zf-HIT) domain-containing proteins family. ZNHIT3 encodes a nuclear zinc finger protein previously implicated in transcriptional regulation and small nucleolar ribonucleoprotein particle assembly and thus possibly to pre-ribosomal RNA processing (PMID: 28335020). ZNHIT3 contains at least two domains: a ZN-HIT domain that consists of a double zinc-finger, probably involved in protein−protein interaction, and a PAC-HIT domain that folds into a clamp able to trap an α-helix, here again of about 20 residues, located in the sequence of NUFIP1 (PMID: 35315277). ZNHIT3 has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29872 Product name: Recombinant human ZNHIT3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-155 aa of BC017931 Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES Predict reactive species Full Name: zinc finger, HIT type 3 Calculated Molecular Weight: 155 aa, 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC017931 Gene Symbol: ZNHIT3 Gene ID (NCBI): 9326 RRID: AB_2935403 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15649 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924