Iright
BRAND / VENDOR: Proteintech

Proteintech, 68347-1-Ig, ZNF266 Monoclonal antibody

CATALOG NUMBER: 68347-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZNF266 (68347-1-Ig) by Proteintech is a Monoclonal antibody targeting ZNF266 in WB, ELISA applications with reactivity to Human samples 68347-1-Ig targets ZNF266 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Saos-2 cells, MDA-MB-231 cells, HeLa cells, HEK-293 cells, MOLT-4 cells, Jurkat cells, K-562 cells, Raji cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ZNF266, also named as HZF1, was expressed in ubiquitous tissues and various hematopoietic cell lines. Expression of ZNF266 in K562 cells was increased after being induced by hemin or phorbol myristate acetate (PMA), suggesting that HZF1 play important roles in erythroid and megakaryocytic differentiation. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28987 Product name: Recombinant human ZNF266 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-293 aa of BC017407 Sequence: MKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIHTGIKPYKCKDCGKAFTQNSDLTKHARTHSGERPYECKECGKAFARSSRLSEHTRTHTGEKPFECVKCGKAFAISSNLSGHLRIHTGEKPFECLECGKAFTHSSSLNNHMRTHSAKKPFTCMECGKAFKFPTCVNLHMRIHTGEKPYKCKQCGKSFSYSNSFQLHERTHTGEKPYECKECGKAFSSSSSFRNHERRHADERLSA Predict reactive species Full Name: zinc finger protein 266 Calculated Molecular Weight: 670 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC017407 Gene Symbol: ZNF266 Gene ID (NCBI): 10781 RRID: AB_3085070 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924