Proteintech, 68362-1-Ig, NDUFB7 Monoclonal antibody

Size: 20ul / 150ul The NDUFB7 (68362-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFB7 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68362-1-Ig targets NDUFB7 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, PC-3 cell, pig heart tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NDUFB7(NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7) is also named as CI-B18 and belongs to the complex I NDUFB7 subunit family. It is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which couples the oxidation of NADH to the reduction of ubiquinone and the translocation of protons across the inner membrane. NDUFB7 protein lacks a mitochondrial targeting signal and transmembrane domains. However, it has a Cx(9)C motif that includes an intermembrane space targeting signal.(PMID:21310150). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6720 Product name: Recombinant human NDUFB7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-137 aa of BC002595 Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC002595 Gene Symbol: NDUFB7 Gene ID (NCBI): 4713 RRID: AB_3085084 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P17568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.