Iright
BRAND / VENDOR: Proteintech

Proteintech, 68375-1-Ig, DICER1 Monoclonal antibody

CATALOG NUMBER: 68375-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DICER1 (68375-1-Ig) by Proteintech is a Monoclonal antibody targeting DICER1 in WB, IF/ICC, IP, ELISA applications with reactivity to Human, mouse samples 68375-1-Ig targets DICER1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, Ramos cells, Sp2/0 cells Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DICER1 functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. DICER1 cleaves naturally occurring long dsRNAs and short hairpin pre-microRNAs (miRNA) into fragments of twenty-one to twenty-three nucleotides with 3' overhang of two nucleotides, and producing respectively short interfering RNAs (siRNA) and mature microRNAs. SiRNAs and miRNAs serve as guide to direct the RNA-induced silencing complex (RISC) to complementary RNAs to degrade them or prevent their translation. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30368 Product name: Recombinant human DICER1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 432-534 aa of NM_030621 Sequence: TNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLV Predict reactive species Full Name: dicer 1, ribonuclease type III Calculated Molecular Weight: 219 kDa Observed Molecular Weight: 240-250 kDa GenBank Accession Number: NM_030621 Gene Symbol: DICER1 Gene ID (NCBI): 23405 RRID: AB_3085094 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UPY3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924