Proteintech, 68377-1-Ig, CEA/CD66e Monoclonal antibody

Size: 20ul / 150ul The CEA/CD66e (68377-1-Ig) by Proteintech is a Monoclonal antibody targeting CEA/CD66e in WB, IHC, ELISA applications with reactivity to human samples 68377-1-Ig targets CEA/CD66e in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HaCaT cells, human saliva, HT-29 cells, human rectum tissue Positive IHC detected in: human colon cancer tissue, human lung tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Background Information Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Eg0247 Product name: Recombinant Human CEACAM5 protein (hIGg2fc Tag) Source: mammalian cells -derived, pINFUSE-IGSF8-CFc2(A2) Tag: C-hIGg2fc Domain: 35-685 aa of BC034671 Sequence: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 5 Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: BC034671 Gene Symbol: CEA Gene ID (NCBI): 1048 RRID: AB_3085095 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P06731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.