Iright
BRAND / VENDOR: Proteintech

Proteintech, 68381-1-Ig, UGP2 Monoclonal antibody

CATALOG NUMBER: 68381-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UGP2 (68381-1-Ig) by Proteintech is a Monoclonal antibody targeting UGP2 in WB, IHC, ELISA applications with reactivity to Human, mouse, Rat, Pig, Rabbit samples 68381-1-Ig targets UGP2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, Rat, Pig, Rabbit samples. Tested Applications Positive WB detected in: HEK-293 cells, pig liver tissue, LNCaP cells, rabbit liver tissue, rat liver tissue, mouse liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information UDP-glucose pyrophosphorylase 2 (UGP2, synonyms: UDPG, UGPP2, UDPGP2, Phc379) is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. So far two isoforms are encoded by two transcript variants have been found. Specification Tested Reactivity: Human, mouse, Rat, Pig, Rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33160 Product name: Recombinant human UGP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-288 aa of BC002954 Sequence: SQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYE Predict reactive species Full Name: UDP-glucose pyrophosphorylase 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 50-56 kDa GenBank Accession Number: BC002954 Gene Symbol: UGP2 Gene ID (NCBI): 7360 RRID: AB_3085099 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16851 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924