Proteintech, 68389-1-Ig, RAB33A Monoclonal antibody

Size: 20ul / 150ul The RAB33A (68389-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB33A in WB, IF/ICC, ELISA applications with reactivity to Human, rat, mouse, pig, rabbit samples 68389-1-Ig targets RAB33A in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, mouse, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, SH-SY5Y cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IF/ICC detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ras-related protein Rab-33A (RAB33A) is also named as RABS10, and belongs to the small GTPase superfamily and the Rab family. RAB33A is an X-linked gene that is expressed in brain, lymphocytes, and normal melanocytes, but is downregulated in melanoma cells. In the brain, RAB33A is present throughout the cortex, as well as in the hippocampal CA fields (PMID:16810302). RAB33A is expressed in cells, including neurons, lymphocytes, melanocytes and parotid acinar cells (PMID:16810302, PMID:25871792). In cultured rat hippocampal neurons, RAB33A is localized to the Golgi apparatus and post-Golgi vesicles transported along axons (PMID:22972995).In addition, RAB33A interacts with singar1/RUFY3, which suppresses the formation of surplus axons in cultured hippocampal neurons (PMID:21737958, PMID:17439943). Specification Tested Reactivity: Human, rat, mouse, pig, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33188 Product name: Recombinant human RAB33A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-237 aa of BC009996 Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC Predict reactive species Full Name: RAB33A, member RAS oncogene family Calculated Molecular Weight: 27 kDa GenBank Accession Number: BC009996 Gene Symbol: RAB33A Gene ID (NCBI): 9363 RRID: AB_3085107 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q14088 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.