Proteintech, 68398-1-Ig, ERGIC3 Monoclonal antibody

Size: 20ul / 150ul The ERGIC3 (68398-1-Ig) by Proteintech is a Monoclonal antibody targeting ERGIC3 in WB, ELISA applications with reactivity to human, mouse, rat samples 68398-1-Ig targets ERGIC3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HepG2 cells, Calu-3 cells, U2OS cells, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ERGIC3 (Endoplasmic reticulum-Golgi intermediate compartment protein 3 ) is located in the cis face of the Golgi apparatus and vesicular tubular structures between the transitional endoplasmic reticulum (ER) and cis-Golgi. ERGIC3 significantly affects cell growth and causes ER stress-induced cell death, and is involved in the invasion and metastasis in hepatocellular carcinomas (HCC). (PMID: 26177443, PMID: 31142615) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9190 Product name: Recombinant human ERGIC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 44-383 aa of BC009765 Sequence: SELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT Predict reactive species Full Name: ERGIC and golgi 3 Calculated Molecular Weight: 383 aa, 43 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC009765 Gene Symbol: ERGIC3 Gene ID (NCBI): 51614 RRID: AB_3085115 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y282 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.