Iright
BRAND / VENDOR: Proteintech

Proteintech, 68402-1-Ig, IGFBP3 Monoclonal antibody

CATALOG NUMBER: 68402-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IGFBP3 (68402-1-Ig) by Proteintech is a Monoclonal antibody targeting IGFBP3 in WB, IHC, ELISA applications with reactivity to human samples 68402-1-Ig targets IGFBP3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, human placenta tissue, Caco-2 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447) Specification Tested Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20351 Product name: Recombinant human IGFBP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 134-291 aa of BC000013 Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK Predict reactive species Full Name: insulin-like growth factor binding protein 3 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 39-45 kDa GenBank Accession Number: BC000013 Gene Symbol: IGFBP3 Gene ID (NCBI): 3486 RRID: AB_3085119 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: P17936 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924