Proteintech, 68409-1-Ig, TBC1D23 Monoclonal antibody

Size: 20ul / 150ul The TBC1D23 (68409-1-Ig) by Proteintech is a Monoclonal antibody targeting TBC1D23 in WB, ELISA applications with reactivity to Human, mouse, rat, pig samples 68409-1-Ig targets TBC1D23 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: U2OS cells, LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TBC1D23, also named as NS4ATP1, is a gene down-regulated by Pneumocystis infection. Pneumocystis pneumonia is a common opportunistic disease in AIDS patients. (PMID: 20377877) Recently it has been found that TBC1D23 gene is the most frequently mutated in MSI-H cell lines and protein expressions of TBC1D23 in tumors with mutation were down regulated.(PMID: 20824714) Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10727 Product name: Recombinant human TBC1D23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-320 aa of BC010221 Sequence: MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES Predict reactive species Full Name: TBC1 domain family, member 23 Calculated Molecular Weight: 699 aa, 78 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC010221 Gene Symbol: TBC1D23 Gene ID (NCBI): 55773 RRID: AB_3085126 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUY8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.