Proteintech, 68433-1-Ig, Centrin 1 Monoclonal antibody

Size: 20ul / 150ul The Centrin 1 (68433-1-Ig) by Proteintech is a Monoclonal antibody targeting Centrin 1 in IF/ICC, ELISA applications with reactivity to Human samples 68433-1-Ig targets Centrin 1 in IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IF/ICC detected in: hTERT-RPE1 cells, ARPE-19 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3529 Product name: Recombinant human CETN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-172 aa of BC029515 Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY Predict reactive species Full Name: centrin, EF-hand protein, 1 Calculated Molecular Weight: 172 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC029515 Gene Symbol: Centrin 1 Gene ID (NCBI): 1068 RRID: AB_3085147 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q12798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.