Proteintech, 68442-1-Ig, ATP6 Monoclonal antibody

Size: 20ul / 150ul The ATP6 (68442-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP6 in WB, ELISA applications with reactivity to Human, Rat samples 68442-1-Ig targets ATP6 in WB, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: rat cerebellum tissue, Rat heart tissue, Rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ATP synthase, also known as FoF1 complex, is a critical mitochondrial OXPHOS enzyme involved in the regulation of mitochondrial ATP production and in the maintenance of the mitochondrial membrane potential. It is composed of three components (F1, Fo and the peripheral stalk). F1, the soluble catalytic core, is above the membrane, inside the matrix of the mitochondria; consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon); Fo, comprising the proton channel, is within the membrane; Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP6 is the a subunit of Fo region. Specification Tested Reactivity: Human, Rat Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31940 Product name: Recombinant human ATP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-68 aa of YP_003024031 Sequence: FPPLLIPTSKYLINNRLITTQQWLIKLTSKQMMTMHNTKGRTW Predict reactive species Full Name: ATP synthase 6; ATPase subunit 6 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: YP_003024031 Gene Symbol: ATP6 Gene ID (NCBI): 4508 RRID: AB_3085155 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00846 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.