Proteintech, 68450-1-Ig, OTUD6B Monoclonal antibody

Size: 20ul / 150ul The OTUD6B (68450-1-Ig) by Proteintech is a Monoclonal antibody targeting OTUD6B in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68450-1-Ig targets OTUD6B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information OTUD6B, also known as DUBA5, belongs to a DUB subfamily characterized by an ovarian tumor domain (OTU). It's a functional deubiquitinating enzyme, a class of protease that specifically cleaves ubiquitin linkages. OTUD6B function may be connected to growth and proliferation. It has been reported that OTUD6B could significantly suppress HCC cells migration and metastasis. The calculated molecular weight of OTUD6B is 34 kDa, 68450-1-Ig can detect the band around 34 kDa.(PMID:32323143) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33607 Product name: Recombinant human OTUD6B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-157 aa of BC029760 Sequence: MEAVLTEELDEEEQLLRRHRKEKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAEAEIENLTGARHMESEKLAQILAARQLEIKQIPSDGH Predict reactive species Full Name: OTU domain containing 6B Calculated Molecular Weight: 293 aa, 34 kDa Observed Molecular Weight: 34-40 kDa GenBank Accession Number: BC029760 Gene Symbol: OTUD6B Gene ID (NCBI): 51633 RRID: AB_3085162 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8N6M0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.