Proteintech, 68454-1-Ig, DDX43 Monoclonal antibody

Size: 20ul / 150ul The DDX43 (68454-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX43 in WB, ELISA applications with reactivity to Human, Rat, Rabbit samples 68454-1-Ig targets DDX43 in WB, ELISA applications and shows reactivity with Human, Rat, Rabbit samples. Tested Applications Positive WB detected in: Calu-3 cells, LNCaP cells, HeLa cells, U2OS cells, DU 145 cells, NCCIT cells, rabbit testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information DDX43 (DEAD-box helicase 43), also known as HAGE (helicase antigen gene), is a member of the DEAD-box protein family. DDX43 is highly expressed in many tumors and is, therefore, considered a potential target for immunotherapy. Specification Tested Reactivity: Human, Rat, Rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11484 Product name: Recombinant human DDX43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 264-648 aa of BC066938 Sequence: KPTPIQSQAWPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITYLVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGTLDLVAVSSVKQNIIVTTEEEKWSHMQTFLQSMSSTDKVIVFVSRKAVADHLSSDLILGNISVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKREMERKMERPQGRPKKFH Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 43 Calculated Molecular Weight: 648 aa, 73 kDa Observed Molecular Weight: 68-73 kDa GenBank Accession Number: BC066938 Gene Symbol: DDX43 Gene ID (NCBI): 55510 RRID: AB_3085166 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NXZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.