Iright
BRAND / VENDOR: Proteintech

Proteintech, 68481-1-Ig, CRYBB2 Monoclonal antibody

CATALOG NUMBER: 68481-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CRYBB2 (68481-1-Ig) by Proteintech is a Monoclonal antibody targeting CRYBB2 in WB, ELISA applications with reactivity to human, mouse, rat, rabbit samples 68481-1-Ig targets CRYBB2 in WB, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rabbit eye tissue, Rat eye tissue, Mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12916 Product name: Recombinant human CRYBB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-205 aa of BC069535 Sequence: MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELNGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKDSSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN Predict reactive species Full Name: crystallin, beta B2 Calculated Molecular Weight: 205 aa, 23 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC069535 Gene Symbol: CRYBB2 Gene ID (NCBI): 1415 RRID: AB_3085192 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P43320 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924