Proteintech, 68485-1-Ig, DNMT1 Monoclonal antibody

Size: 20ul / 150ul The DNMT1 (68485-1-Ig) by Proteintech is a Monoclonal antibody targeting DNMT1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68485-1-Ig targets DNMT1 in WB, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866) Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19116 Product name: Recombinant human DNMT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1288-1632 aa of BC126227 Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD Predict reactive species Full Name: DNA (cytosine-5-)-methyltransferase 1 Calculated Molecular Weight: 1632 aa, 185 kDa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: BC126227 Gene Symbol: DNMT1 Gene ID (NCBI): 1786 RRID: AB_3085196 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P26358 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.