Iright
BRAND / VENDOR: Proteintech

Proteintech, 68486-1-Ig, TIA1 Monoclonal antibody

CATALOG NUMBER: 68486-1-Ig
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TIA1 (68486-1-Ig) by Proteintech is a Monoclonal antibody targeting TIA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 68486-1-Ig targets TIA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, hTERT-RPE1 cells, HepG2 cells, COLO 320 cells, MOLT-4 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse liver tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TIA1, also named as p40-TIA-1, is involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). It possesses nucleolytic activity against cytotoxic lymphocyte target cells. TIA1 may be involved in apoptosis. Two isoforms of this protein exist - 41kDa and 42kDa. one of these was a missense variant (P362L) in TIA1. Similar to the ALS-related disease proteins TDP-43, hnRNPA1, and FUS, TIA1 is an RNA-binding protein containing a prionlike LCD and assembles into membrane-less organelles, including SGs. Postmortem neuropathology of five TIA1 mutations carriers showed a consistent pathological signature with numerous round, hyaline, TAR DNA-binding protein 43 (TDP-43)-positive inclusions.TIA1mutations significantly increased the propensity of TIA1 protein to undergo phase transition. In live cells,TIA1mutations delayed stress granule (SG) disassembly and promoted the accumulation of non-dynamic SGs that harbored TDP-43. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2778 Product name: Recombinant human TIA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC015944 Sequence: MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF Predict reactive species Full Name: TIA1 cytotoxic granule-associated RNA binding protein Calculated Molecular Weight: 214 aa, 24 kDa, 43 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC015944 Gene Symbol: TIA1 Gene ID (NCBI): 7072 RRID: AB_3085197 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31483 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924