Proteintech, 68490-1-Ig, ABCF2 Monoclonal antibody

Size: 20ul / 150ul The ABCF2 (68490-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCF2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68490-1-Ig targets ABCF2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells, Jurkat cells, MOLT-4 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 clls Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information ABCF2 (ABC28, M-ABC1, HUSSY-18, EST133090, DKFZp586K1823) is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins are composed of transmembrane domains (TMDs), and nucleotide binding domains (NBDs, or ATP-binding cassettes, ABSs). Based on their sequence similarity scores, the members of the human ABC protein family can be grouped into eight subfamilies, including the MDR/TAP, the ALD, the MRP/CFTR, the ABC1, the White, the RNAseL inhibitor, the ANSA, and the GCN20 subfamilies. ABCF2 is a member of the GCN20 subfamily. ABC proteins transport various molecules across extra- and intracellular membranes. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33824 Product name: Recombinant human ABCF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-216 aa of BC001661 Sequence: PSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLG Predict reactive species Full Name: ATP-binding cassette, sub-family F (GCN20), member 2 Calculated Molecular Weight: 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC001661 Gene Symbol: ABCF2 Gene ID (NCBI): 10061 RRID: AB_3085201 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UG63 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.