Proteintech, 68491-1-Ig, FLAD1 Monoclonal antibody

Size: 20ul / 150ul The FLAD1 (68491-1-Ig) by Proteintech is a Monoclonal antibody targeting FLAD1 in WB, ELISA applications with reactivity to human samples 68491-1-Ig targets FLAD1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, U2OS cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FLAD1 is a protein-coding gene for flavin adenine dinucleotide synthetase (FADS), a key enzyme in the FAD biosynthesis process which contains an N-terminal molybdopterin -binding (MPTb) domain and a C-terminal domain (FADS domain) (PMID: 32714079). Alternative splicing of the human FLAD1 gene generates different isoforms of the enzyme FAD synthase. ~60 and ~50 kDa bands correspond to the expected mitochondrial FADS1 and cytosolic FADS2 proteins, respectively (PMID: 29316637). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6845 Product name: Recombinant human FLAD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 148-447 aa of BC011378 Sequence: LVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEAQAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSSLGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQDTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDIWDFLRQLFVPYCILYDRG Predict reactive species Full Name: FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae) Calculated Molecular Weight: 446 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC011378 Gene Symbol: FLAD1 Gene ID (NCBI): 80308 RRID: AB_3085202 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NFF5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.