Proteintech, 68492-1-Ig, CIAPIN1 Monoclonal antibody

Size: 20ul / 150ul The CIAPIN1 (68492-1-Ig) by Proteintech is a Monoclonal antibody targeting CIAPIN1 in WB, ELISA applications with reactivity to Human samples 68492-1-Ig targets CIAPIN1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The cytokine-induced anti-apoptotic molecule (CIAPIN1, or DRE2) had been found to be a differentially-expressed gene involved in a variety of cancers, and it was also considered as a candidate tumor suppressor gene in gastric cancer, renal cancer and liver cancer. CIAPIN1 plays an important role in the differentiation of colorectal cancer (CRC) cells, and the differential expression of CIAPIN1 in CRC was closely related to prognosis. CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a valuable prognostic indicator in esophageal squamous cell carcinoma (ESCC). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33193 Product name: Recombinant human CIAPIN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC024196 Sequence: MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA Predict reactive species Full Name: cytokine induced apoptosis inhibitor 1 Calculated Molecular Weight: 312 aa, 34 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC024196 Gene Symbol: CIAPIN1 Gene ID (NCBI): 57019 RRID: AB_3085203 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6FI81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.